published on Monday, May 4, 2026 by fortinetdev
published on Monday, May 4, 2026 by fortinetdev
SD-WAN status checking or health checking. Identify a server on the Internet and determine how SD-WAN verifies that the FortiGate can communicate with it.
This resource is a sub resource for variable
health_checkof resourcefortimanager.WantempSystemSdwan. Conflict and overwrite may occur if use both of them. The following variables have sub resource. Avoid using them together, otherwise conflicts and overwrites may occur.
sla:fortimanager.WantempSystemSdwanHealthcheckSla
Example Usage
import * as pulumi from "@pulumi/pulumi";
import * as fortimanager from "@pulumi/fortimanager";
const trnameWanTemplate = new fortimanager.WanTemplate("trname", {
name: "terr21",
adom: "root",
type: "wanprof",
});
const trname = new fortimanager.WantempSystemSdwanHealthcheck("trname", {
addrMode: "ipv4",
name: "healthcheck",
wanprof: trnameWanTemplate.name,
}, {
dependsOn: [trnameWanTemplate],
});
import pulumi
import pulumi_fortimanager as fortimanager
trname_wan_template = fortimanager.WanTemplate("trname",
name="terr21",
adom="root",
type="wanprof")
trname = fortimanager.WantempSystemSdwanHealthcheck("trname",
addr_mode="ipv4",
name="healthcheck",
wanprof=trname_wan_template.name,
opts = pulumi.ResourceOptions(depends_on=[trname_wan_template]))
package main
import (
"github.com/pulumi/pulumi-terraform-provider/sdks/go/fortimanager/fortimanager"
"github.com/pulumi/pulumi/sdk/v3/go/pulumi"
)
func main() {
pulumi.Run(func(ctx *pulumi.Context) error {
trnameWanTemplate, err := fortimanager.NewWanTemplate(ctx, "trname", &fortimanager.WanTemplateArgs{
Name: pulumi.String("terr21"),
Adom: pulumi.String("root"),
Type: pulumi.String("wanprof"),
})
if err != nil {
return err
}
_, err = fortimanager.NewWantempSystemSdwanHealthcheck(ctx, "trname", &fortimanager.WantempSystemSdwanHealthcheckArgs{
AddrMode: pulumi.String("ipv4"),
Name: pulumi.String("healthcheck"),
Wanprof: trnameWanTemplate.Name,
}, pulumi.DependsOn([]pulumi.Resource{
trnameWanTemplate,
}))
if err != nil {
return err
}
return nil
})
}
using System.Collections.Generic;
using System.Linq;
using Pulumi;
using Fortimanager = Pulumi.Fortimanager;
return await Deployment.RunAsync(() =>
{
var trnameWanTemplate = new Fortimanager.WanTemplate("trname", new()
{
Name = "terr21",
Adom = "root",
Type = "wanprof",
});
var trname = new Fortimanager.WantempSystemSdwanHealthcheck("trname", new()
{
AddrMode = "ipv4",
Name = "healthcheck",
Wanprof = trnameWanTemplate.Name,
}, new CustomResourceOptions
{
DependsOn =
{
trnameWanTemplate,
},
});
});
package generated_program;
import com.pulumi.Context;
import com.pulumi.Pulumi;
import com.pulumi.core.Output;
import com.pulumi.fortimanager.WanTemplate;
import com.pulumi.fortimanager.WanTemplateArgs;
import com.pulumi.fortimanager.WantempSystemSdwanHealthcheck;
import com.pulumi.fortimanager.WantempSystemSdwanHealthcheckArgs;
import com.pulumi.resources.CustomResourceOptions;
import java.util.List;
import java.util.ArrayList;
import java.util.Map;
import java.io.File;
import java.nio.file.Files;
import java.nio.file.Paths;
public class App {
public static void main(String[] args) {
Pulumi.run(App::stack);
}
public static void stack(Context ctx) {
var trnameWanTemplate = new WanTemplate("trnameWanTemplate", WanTemplateArgs.builder()
.name("terr21")
.adom("root")
.type("wanprof")
.build());
var trname = new WantempSystemSdwanHealthcheck("trname", WantempSystemSdwanHealthcheckArgs.builder()
.addrMode("ipv4")
.name("healthcheck")
.wanprof(trnameWanTemplate.name())
.build(), CustomResourceOptions.builder()
.dependsOn(trnameWanTemplate)
.build());
}
}
resources:
trname:
type: fortimanager:WantempSystemSdwanHealthcheck
properties:
addrMode: ipv4
name: healthcheck
wanprof: ${trnameWanTemplate.name}
options:
dependsOn:
- ${trnameWanTemplate}
trnameWanTemplate:
type: fortimanager:WanTemplate
name: trname
properties:
name: terr21
adom: root
type: wanprof
Example coming soon!
Create WantempSystemSdwanHealthcheck Resource
Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.
Constructor syntax
new WantempSystemSdwanHealthcheck(name: string, args: WantempSystemSdwanHealthcheckArgs, opts?: CustomResourceOptions);@overload
def WantempSystemSdwanHealthcheck(resource_name: str,
args: WantempSystemSdwanHealthcheckArgs,
opts: Optional[ResourceOptions] = None)
@overload
def WantempSystemSdwanHealthcheck(resource_name: str,
opts: Optional[ResourceOptions] = None,
wanprof: Optional[str] = None,
_dynamic_server: Optional[str] = None,
addr_mode: Optional[str] = None,
adom: Optional[str] = None,
agent_probe_timeout: Optional[float] = None,
bandwidth_weight: Optional[float] = None,
class_id: Optional[str] = None,
detect_mode: Optional[str] = None,
diffservcode: Optional[str] = None,
dns_match_ip: Optional[str] = None,
dns_request_domain: Optional[str] = None,
dynamic_sort_subtable: Optional[str] = None,
embed_measured_health: Optional[str] = None,
failtime: Optional[float] = None,
fortiguard: Optional[str] = None,
fortiguard_names: Optional[Sequence[str]] = None,
ftp_file: Optional[str] = None,
ftp_mode: Optional[str] = None,
ha_priority: Optional[float] = None,
http_agent: Optional[str] = None,
http_get: Optional[str] = None,
http_match: Optional[str] = None,
interval: Optional[float] = None,
jitter_weight: Optional[float] = None,
latency_weight: Optional[float] = None,
members: Optional[Sequence[str]] = None,
mos_codec: Optional[str] = None,
name: Optional[str] = None,
packet_loss_weight: Optional[float] = None,
packet_size: Optional[float] = None,
passwords: Optional[Sequence[str]] = None,
port: Optional[float] = None,
probe_count: Optional[float] = None,
probe_packets: Optional[str] = None,
probe_timeout: Optional[float] = None,
protocol: Optional[str] = None,
quality_measured_method: Optional[str] = None,
recoverytime: Optional[float] = None,
remote_probe_timeout: Optional[float] = None,
scopetype: Optional[str] = None,
security_mode: Optional[str] = None,
servers: Optional[Sequence[str]] = None,
sla_fail_log_period: Optional[float] = None,
sla_id_redistribute: Optional[float] = None,
sla_pass_log_period: Optional[float] = None,
slas: Optional[Sequence[WantempSystemSdwanHealthcheckSlaArgs]] = None,
source: Optional[str] = None,
source6: Optional[str] = None,
system_dns: Optional[str] = None,
threshold_alert_jitter: Optional[float] = None,
threshold_alert_latency: Optional[float] = None,
threshold_alert_packetloss: Optional[float] = None,
threshold_warning_jitter: Optional[float] = None,
threshold_warning_latency: Optional[float] = None,
threshold_warning_packetloss: Optional[float] = None,
update_bgp_route: Optional[str] = None,
update_cascade_interface: Optional[str] = None,
update_if_exist: Optional[bool] = None,
update_static_route: Optional[str] = None,
user: Optional[str] = None,
vrf: Optional[float] = None,
wantemp_system_sdwan_healthcheck_id: Optional[str] = None)func NewWantempSystemSdwanHealthcheck(ctx *Context, name string, args WantempSystemSdwanHealthcheckArgs, opts ...ResourceOption) (*WantempSystemSdwanHealthcheck, error)public WantempSystemSdwanHealthcheck(string name, WantempSystemSdwanHealthcheckArgs args, CustomResourceOptions? opts = null)
public WantempSystemSdwanHealthcheck(String name, WantempSystemSdwanHealthcheckArgs args)
public WantempSystemSdwanHealthcheck(String name, WantempSystemSdwanHealthcheckArgs args, CustomResourceOptions options)
type: fortimanager:WantempSystemSdwanHealthcheck
properties: # The arguments to resource properties.
options: # Bag of options to control resource's behavior.
resource "fortimanager_wantempsystemsdwanhealthcheck" "name" {
# resource properties
}Parameters
- name string
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- resource_name str
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckArgs
- The arguments to resource properties.
- opts ResourceOptions
- Bag of options to control resource's behavior.
- ctx Context
- Context object for the current deployment.
- name string
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckArgs
- The arguments to resource properties.
- opts ResourceOption
- Bag of options to control resource's behavior.
- name string
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- name String
- The unique name of the resource.
- args WantempSystemSdwanHealthcheckArgs
- The arguments to resource properties.
- options CustomResourceOptions
- Bag of options to control resource's behavior.
Constructor example
The following reference example uses placeholder values for all input properties.
var wantempSystemSdwanHealthcheckResource = new Fortimanager.WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource", new()
{
Wanprof = "string",
_dynamicServer = "string",
AddrMode = "string",
Adom = "string",
AgentProbeTimeout = 0,
BandwidthWeight = 0,
ClassId = "string",
DetectMode = "string",
Diffservcode = "string",
DnsMatchIp = "string",
DnsRequestDomain = "string",
DynamicSortSubtable = "string",
EmbedMeasuredHealth = "string",
Failtime = 0,
Fortiguard = "string",
FortiguardNames = new[]
{
"string",
},
FtpFile = "string",
FtpMode = "string",
HaPriority = 0,
HttpAgent = "string",
HttpGet = "string",
HttpMatch = "string",
Interval = 0,
JitterWeight = 0,
LatencyWeight = 0,
Members = new[]
{
"string",
},
MosCodec = "string",
Name = "string",
PacketLossWeight = 0,
PacketSize = 0,
Passwords = new[]
{
"string",
},
Port = 0,
ProbeCount = 0,
ProbePackets = "string",
ProbeTimeout = 0,
Protocol = "string",
QualityMeasuredMethod = "string",
Recoverytime = 0,
RemoteProbeTimeout = 0,
Scopetype = "string",
SecurityMode = "string",
Servers = new[]
{
"string",
},
SlaFailLogPeriod = 0,
SlaIdRedistribute = 0,
SlaPassLogPeriod = 0,
Slas = new[]
{
new Fortimanager.Inputs.WantempSystemSdwanHealthcheckSlaArgs
{
CustomProfileThreshold = 0,
Id = 0,
JitterThreshold = 0,
LatencyThreshold = 0,
LinkCostFactors = new[]
{
"string",
},
MosThreshold = "string",
PacketlossThreshold = 0,
PriorityInSla = 0,
PriorityOutSla = 0,
},
},
Source = "string",
Source6 = "string",
SystemDns = "string",
ThresholdAlertJitter = 0,
ThresholdAlertLatency = 0,
ThresholdAlertPacketloss = 0,
ThresholdWarningJitter = 0,
ThresholdWarningLatency = 0,
ThresholdWarningPacketloss = 0,
UpdateBgpRoute = "string",
UpdateCascadeInterface = "string",
UpdateIfExist = false,
UpdateStaticRoute = "string",
User = "string",
Vrf = 0,
WantempSystemSdwanHealthcheckId = "string",
});
example, err := fortimanager.NewWantempSystemSdwanHealthcheck(ctx, "wantempSystemSdwanHealthcheckResource", &fortimanager.WantempSystemSdwanHealthcheckArgs{
Wanprof: pulumi.String("string"),
_dynamicServer: pulumi.String("string"),
AddrMode: pulumi.String("string"),
Adom: pulumi.String("string"),
AgentProbeTimeout: pulumi.Float64(0),
BandwidthWeight: pulumi.Float64(0),
ClassId: pulumi.String("string"),
DetectMode: pulumi.String("string"),
Diffservcode: pulumi.String("string"),
DnsMatchIp: pulumi.String("string"),
DnsRequestDomain: pulumi.String("string"),
DynamicSortSubtable: pulumi.String("string"),
EmbedMeasuredHealth: pulumi.String("string"),
Failtime: pulumi.Float64(0),
Fortiguard: pulumi.String("string"),
FortiguardNames: pulumi.StringArray{
pulumi.String("string"),
},
FtpFile: pulumi.String("string"),
FtpMode: pulumi.String("string"),
HaPriority: pulumi.Float64(0),
HttpAgent: pulumi.String("string"),
HttpGet: pulumi.String("string"),
HttpMatch: pulumi.String("string"),
Interval: pulumi.Float64(0),
JitterWeight: pulumi.Float64(0),
LatencyWeight: pulumi.Float64(0),
Members: pulumi.StringArray{
pulumi.String("string"),
},
MosCodec: pulumi.String("string"),
Name: pulumi.String("string"),
PacketLossWeight: pulumi.Float64(0),
PacketSize: pulumi.Float64(0),
Passwords: pulumi.StringArray{
pulumi.String("string"),
},
Port: pulumi.Float64(0),
ProbeCount: pulumi.Float64(0),
ProbePackets: pulumi.String("string"),
ProbeTimeout: pulumi.Float64(0),
Protocol: pulumi.String("string"),
QualityMeasuredMethod: pulumi.String("string"),
Recoverytime: pulumi.Float64(0),
RemoteProbeTimeout: pulumi.Float64(0),
Scopetype: pulumi.String("string"),
SecurityMode: pulumi.String("string"),
Servers: pulumi.StringArray{
pulumi.String("string"),
},
SlaFailLogPeriod: pulumi.Float64(0),
SlaIdRedistribute: pulumi.Float64(0),
SlaPassLogPeriod: pulumi.Float64(0),
Slas: fortimanager.WantempSystemSdwanHealthcheckSlaTypeArray{
&fortimanager.WantempSystemSdwanHealthcheckSlaTypeArgs{
CustomProfileThreshold: pulumi.Float64(0),
Id: pulumi.Float64(0),
JitterThreshold: pulumi.Float64(0),
LatencyThreshold: pulumi.Float64(0),
LinkCostFactors: pulumi.StringArray{
pulumi.String("string"),
},
MosThreshold: pulumi.String("string"),
PacketlossThreshold: pulumi.Float64(0),
PriorityInSla: pulumi.Float64(0),
PriorityOutSla: pulumi.Float64(0),
},
},
Source: pulumi.String("string"),
Source6: pulumi.String("string"),
SystemDns: pulumi.String("string"),
ThresholdAlertJitter: pulumi.Float64(0),
ThresholdAlertLatency: pulumi.Float64(0),
ThresholdAlertPacketloss: pulumi.Float64(0),
ThresholdWarningJitter: pulumi.Float64(0),
ThresholdWarningLatency: pulumi.Float64(0),
ThresholdWarningPacketloss: pulumi.Float64(0),
UpdateBgpRoute: pulumi.String("string"),
UpdateCascadeInterface: pulumi.String("string"),
UpdateIfExist: pulumi.Bool(false),
UpdateStaticRoute: pulumi.String("string"),
User: pulumi.String("string"),
Vrf: pulumi.Float64(0),
WantempSystemSdwanHealthcheckId: pulumi.String("string"),
})
resource "fortimanager_wantempsystemsdwanhealthcheck" "wantempSystemSdwanHealthcheckResource" {
wanprof = "string"
_dynamic_server = "string"
addr_mode = "string"
adom = "string"
agent_probe_timeout = 0
bandwidth_weight = 0
class_id = "string"
detect_mode = "string"
diffservcode = "string"
dns_match_ip = "string"
dns_request_domain = "string"
dynamic_sort_subtable = "string"
embed_measured_health = "string"
failtime = 0
fortiguard = "string"
fortiguard_names = ["string"]
ftp_file = "string"
ftp_mode = "string"
ha_priority = 0
http_agent = "string"
http_get = "string"
http_match = "string"
interval = 0
jitter_weight = 0
latency_weight = 0
members = ["string"]
mos_codec = "string"
name = "string"
packet_loss_weight = 0
packet_size = 0
passwords = ["string"]
port = 0
probe_count = 0
probe_packets = "string"
probe_timeout = 0
protocol = "string"
quality_measured_method = "string"
recoverytime = 0
remote_probe_timeout = 0
scopetype = "string"
security_mode = "string"
servers = ["string"]
sla_fail_log_period = 0
sla_id_redistribute = 0
sla_pass_log_period = 0
slas {
custom_profile_threshold = 0
id = 0
jitter_threshold = 0
latency_threshold = 0
link_cost_factors = ["string"]
mos_threshold = "string"
packetloss_threshold = 0
priority_in_sla = 0
priority_out_sla = 0
}
source = "string"
source6 = "string"
system_dns = "string"
threshold_alert_jitter = 0
threshold_alert_latency = 0
threshold_alert_packetloss = 0
threshold_warning_jitter = 0
threshold_warning_latency = 0
threshold_warning_packetloss = 0
update_bgp_route = "string"
update_cascade_interface = "string"
update_if_exist = false
update_static_route = "string"
user = "string"
vrf = 0
wantemp_system_sdwan_healthcheck_id = "string"
}
var wantempSystemSdwanHealthcheckResource = new WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource", WantempSystemSdwanHealthcheckArgs.builder()
.wanprof("string")
._dynamicServer("string")
.addrMode("string")
.adom("string")
.agentProbeTimeout(0.0)
.bandwidthWeight(0.0)
.classId("string")
.detectMode("string")
.diffservcode("string")
.dnsMatchIp("string")
.dnsRequestDomain("string")
.dynamicSortSubtable("string")
.embedMeasuredHealth("string")
.failtime(0.0)
.fortiguard("string")
.fortiguardNames("string")
.ftpFile("string")
.ftpMode("string")
.haPriority(0.0)
.httpAgent("string")
.httpGet("string")
.httpMatch("string")
.interval(0.0)
.jitterWeight(0.0)
.latencyWeight(0.0)
.members("string")
.mosCodec("string")
.name("string")
.packetLossWeight(0.0)
.packetSize(0.0)
.passwords("string")
.port(0.0)
.probeCount(0.0)
.probePackets("string")
.probeTimeout(0.0)
.protocol("string")
.qualityMeasuredMethod("string")
.recoverytime(0.0)
.remoteProbeTimeout(0.0)
.scopetype("string")
.securityMode("string")
.servers("string")
.slaFailLogPeriod(0.0)
.slaIdRedistribute(0.0)
.slaPassLogPeriod(0.0)
.slas(WantempSystemSdwanHealthcheckSlaArgs.builder()
.customProfileThreshold(0.0)
.id(0.0)
.jitterThreshold(0.0)
.latencyThreshold(0.0)
.linkCostFactors("string")
.mosThreshold("string")
.packetlossThreshold(0.0)
.priorityInSla(0.0)
.priorityOutSla(0.0)
.build())
.source("string")
.source6("string")
.systemDns("string")
.thresholdAlertJitter(0.0)
.thresholdAlertLatency(0.0)
.thresholdAlertPacketloss(0.0)
.thresholdWarningJitter(0.0)
.thresholdWarningLatency(0.0)
.thresholdWarningPacketloss(0.0)
.updateBgpRoute("string")
.updateCascadeInterface("string")
.updateIfExist(false)
.updateStaticRoute("string")
.user("string")
.vrf(0.0)
.wantempSystemSdwanHealthcheckId("string")
.build());
wantemp_system_sdwan_healthcheck_resource = fortimanager.WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource",
wanprof="string",
_dynamic_server="string",
addr_mode="string",
adom="string",
agent_probe_timeout=float(0),
bandwidth_weight=float(0),
class_id="string",
detect_mode="string",
diffservcode="string",
dns_match_ip="string",
dns_request_domain="string",
dynamic_sort_subtable="string",
embed_measured_health="string",
failtime=float(0),
fortiguard="string",
fortiguard_names=["string"],
ftp_file="string",
ftp_mode="string",
ha_priority=float(0),
http_agent="string",
http_get="string",
http_match="string",
interval=float(0),
jitter_weight=float(0),
latency_weight=float(0),
members=["string"],
mos_codec="string",
name="string",
packet_loss_weight=float(0),
packet_size=float(0),
passwords=["string"],
port=float(0),
probe_count=float(0),
probe_packets="string",
probe_timeout=float(0),
protocol="string",
quality_measured_method="string",
recoverytime=float(0),
remote_probe_timeout=float(0),
scopetype="string",
security_mode="string",
servers=["string"],
sla_fail_log_period=float(0),
sla_id_redistribute=float(0),
sla_pass_log_period=float(0),
slas=[{
"custom_profile_threshold": float(0),
"id": float(0),
"jitter_threshold": float(0),
"latency_threshold": float(0),
"link_cost_factors": ["string"],
"mos_threshold": "string",
"packetloss_threshold": float(0),
"priority_in_sla": float(0),
"priority_out_sla": float(0),
}],
source="string",
source6="string",
system_dns="string",
threshold_alert_jitter=float(0),
threshold_alert_latency=float(0),
threshold_alert_packetloss=float(0),
threshold_warning_jitter=float(0),
threshold_warning_latency=float(0),
threshold_warning_packetloss=float(0),
update_bgp_route="string",
update_cascade_interface="string",
update_if_exist=False,
update_static_route="string",
user="string",
vrf=float(0),
wantemp_system_sdwan_healthcheck_id="string")
const wantempSystemSdwanHealthcheckResource = new fortimanager.WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource", {
wanprof: "string",
_dynamicServer: "string",
addrMode: "string",
adom: "string",
agentProbeTimeout: 0,
bandwidthWeight: 0,
classId: "string",
detectMode: "string",
diffservcode: "string",
dnsMatchIp: "string",
dnsRequestDomain: "string",
dynamicSortSubtable: "string",
embedMeasuredHealth: "string",
failtime: 0,
fortiguard: "string",
fortiguardNames: ["string"],
ftpFile: "string",
ftpMode: "string",
haPriority: 0,
httpAgent: "string",
httpGet: "string",
httpMatch: "string",
interval: 0,
jitterWeight: 0,
latencyWeight: 0,
members: ["string"],
mosCodec: "string",
name: "string",
packetLossWeight: 0,
packetSize: 0,
passwords: ["string"],
port: 0,
probeCount: 0,
probePackets: "string",
probeTimeout: 0,
protocol: "string",
qualityMeasuredMethod: "string",
recoverytime: 0,
remoteProbeTimeout: 0,
scopetype: "string",
securityMode: "string",
servers: ["string"],
slaFailLogPeriod: 0,
slaIdRedistribute: 0,
slaPassLogPeriod: 0,
slas: [{
customProfileThreshold: 0,
id: 0,
jitterThreshold: 0,
latencyThreshold: 0,
linkCostFactors: ["string"],
mosThreshold: "string",
packetlossThreshold: 0,
priorityInSla: 0,
priorityOutSla: 0,
}],
source: "string",
source6: "string",
systemDns: "string",
thresholdAlertJitter: 0,
thresholdAlertLatency: 0,
thresholdAlertPacketloss: 0,
thresholdWarningJitter: 0,
thresholdWarningLatency: 0,
thresholdWarningPacketloss: 0,
updateBgpRoute: "string",
updateCascadeInterface: "string",
updateIfExist: false,
updateStaticRoute: "string",
user: "string",
vrf: 0,
wantempSystemSdwanHealthcheckId: "string",
});
type: fortimanager:WantempSystemSdwanHealthcheck
properties:
_dynamicServer: string
addrMode: string
adom: string
agentProbeTimeout: 0
bandwidthWeight: 0
classId: string
detectMode: string
diffservcode: string
dnsMatchIp: string
dnsRequestDomain: string
dynamicSortSubtable: string
embedMeasuredHealth: string
failtime: 0
fortiguard: string
fortiguardNames:
- string
ftpFile: string
ftpMode: string
haPriority: 0
httpAgent: string
httpGet: string
httpMatch: string
interval: 0
jitterWeight: 0
latencyWeight: 0
members:
- string
mosCodec: string
name: string
packetLossWeight: 0
packetSize: 0
passwords:
- string
port: 0
probeCount: 0
probePackets: string
probeTimeout: 0
protocol: string
qualityMeasuredMethod: string
recoverytime: 0
remoteProbeTimeout: 0
scopetype: string
securityMode: string
servers:
- string
slaFailLogPeriod: 0
slaIdRedistribute: 0
slaPassLogPeriod: 0
slas:
- customProfileThreshold: 0
id: 0
jitterThreshold: 0
latencyThreshold: 0
linkCostFactors:
- string
mosThreshold: string
packetlossThreshold: 0
priorityInSla: 0
priorityOutSla: 0
source: string
source6: string
systemDns: string
thresholdAlertJitter: 0
thresholdAlertLatency: 0
thresholdAlertPacketloss: 0
thresholdWarningJitter: 0
thresholdWarningLatency: 0
thresholdWarningPacketloss: 0
updateBgpRoute: string
updateCascadeInterface: string
updateIfExist: false
updateStaticRoute: string
user: string
vrf: 0
wanprof: string
wantempSystemSdwanHealthcheckId: string
WantempSystemSdwanHealthcheck Resource Properties
To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.
Inputs
In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.
The WantempSystemSdwanHealthcheck resource accepts the following input properties:
- Wanprof string
- Wanprof.
- Addr
Mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Agent
Probe doubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- Bandwidth
Weight double - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- Class
Id string - Traffic class ID.
- Detect
Mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - Diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- Dns
Match stringIp - Response IP expected from DNS server if the protocol is DNS.
- Dns
Request stringDomain - Fully qualified domain name to resolve for the DNS probe.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Embed
Measured stringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - Failtime double
- Number of failures before server is considered lost (1 - 3600, default = 5).
- Fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - Fortiguard
Names List<string> - Predefined health-check target name.
- Ftp
File string - Full path and file name on the FTP server to download for FTP health-check to probe.
- Ftp
Mode string - FTP mode. Valid values:
passive,port. - Ha
Priority double - HA election priority (1 - 50).
- Http
Agent string - String in the http-agent field in the HTTP header.
- Http
Get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- Http
Match string - Response string expected from the server if the protocol is HTTP.
- Interval double
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- Jitter
Weight double - Coefficient of jitter in the formula of custom-profile-1.
- Latency
Weight double - Coefficient of latency in the formula of custom-profile-1.
- Members List<string>
- Member sequence number list.
- Mos
Codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - Name string
- Status check or health check name.
- Packet
Loss doubleWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- Packet
Size double - Packet size of a twamp test session,
- Passwords List<string>
- Twamp controller password in authentication mode
- Port double
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- Probe
Count double - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- Probe
Packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - Probe
Timeout double - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- Protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - Quality
Measured stringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - Recoverytime double
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- Remote
Probe doubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Security
Mode string - Twamp controller security mode. Valid values:
none,authentication. - Servers List<string>
- IP address or FQDN name of the server.
- Sla
Fail doubleLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- Sla
Id doubleRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- Sla
Pass doubleLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- Slas
List<Wantemp
System Sdwan Healthcheck Sla> - Sla. The structure of
slablock is documented below. - Source string
- Source IP address used in the health-check packet to the server.
- Source6 string
- Source IPv6 addressused in the health-check packet to server.
- System
Dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - Threshold
Alert doubleJitter - Alert threshold for jitter (ms, default = 0).
- Threshold
Alert doubleLatency - Alert threshold for latency (ms, default = 0).
- Threshold
Alert doublePacketloss - Alert threshold for packet loss (percentage, default = 0).
- Threshold
Warning doubleJitter - Warning threshold for jitter (ms, default = 0).
- Threshold
Warning doubleLatency - Warning threshold for latency (ms, default = 0).
- Threshold
Warning doublePacketloss - Warning threshold for packet loss (percentage, default = 0).
- Update
Bgp stringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - Update
Cascade stringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - Update
If boolExist - Update
Static stringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - User string
- The user name to access probe server.
- Vrf double
- Virtual Routing Forwarding ID.
- Wantemp
System stringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- _
dynamic stringServer - _Dynamic-Server.
- Wanprof string
- Wanprof.
- Addr
Mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Agent
Probe float64Timeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- Bandwidth
Weight float64 - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- Class
Id string - Traffic class ID.
- Detect
Mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - Diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- Dns
Match stringIp - Response IP expected from DNS server if the protocol is DNS.
- Dns
Request stringDomain - Fully qualified domain name to resolve for the DNS probe.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Embed
Measured stringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - Failtime float64
- Number of failures before server is considered lost (1 - 3600, default = 5).
- Fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - Fortiguard
Names []string - Predefined health-check target name.
- Ftp
File string - Full path and file name on the FTP server to download for FTP health-check to probe.
- Ftp
Mode string - FTP mode. Valid values:
passive,port. - Ha
Priority float64 - HA election priority (1 - 50).
- Http
Agent string - String in the http-agent field in the HTTP header.
- Http
Get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- Http
Match string - Response string expected from the server if the protocol is HTTP.
- Interval float64
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- Jitter
Weight float64 - Coefficient of jitter in the formula of custom-profile-1.
- Latency
Weight float64 - Coefficient of latency in the formula of custom-profile-1.
- Members []string
- Member sequence number list.
- Mos
Codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - Name string
- Status check or health check name.
- Packet
Loss float64Weight - Coefficient of packet-loss in the formula of custom-profile-1.
- Packet
Size float64 - Packet size of a twamp test session,
- Passwords []string
- Twamp controller password in authentication mode
- Port float64
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- Probe
Count float64 - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- Probe
Packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - Probe
Timeout float64 - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- Protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - Quality
Measured stringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - Recoverytime float64
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- Remote
Probe float64Timeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Security
Mode string - Twamp controller security mode. Valid values:
none,authentication. - Servers []string
- IP address or FQDN name of the server.
- Sla
Fail float64Log Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- Sla
Id float64Redistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- Sla
Pass float64Log Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- Slas
[]Wantemp
System Sdwan Healthcheck Sla Type Args - Sla. The structure of
slablock is documented below. - Source string
- Source IP address used in the health-check packet to the server.
- Source6 string
- Source IPv6 addressused in the health-check packet to server.
- System
Dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - Threshold
Alert float64Jitter - Alert threshold for jitter (ms, default = 0).
- Threshold
Alert float64Latency - Alert threshold for latency (ms, default = 0).
- Threshold
Alert float64Packetloss - Alert threshold for packet loss (percentage, default = 0).
- Threshold
Warning float64Jitter - Warning threshold for jitter (ms, default = 0).
- Threshold
Warning float64Latency - Warning threshold for latency (ms, default = 0).
- Threshold
Warning float64Packetloss - Warning threshold for packet loss (percentage, default = 0).
- Update
Bgp stringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - Update
Cascade stringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - Update
If boolExist - Update
Static stringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - User string
- The user name to access probe server.
- Vrf float64
- Virtual Routing Forwarding ID.
- Wantemp
System stringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- _
dynamic stringServer - _Dynamic-Server.
- wanprof string
- Wanprof.
- _
dynamic_ stringserver - _Dynamic-Server.
- addr_
mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent_
probe_ numbertimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth_
weight number - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class_
id string - Traffic class ID.
- detect_
mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns_
match_ stringip - Response IP expected from DNS server if the protocol is DNS.
- dns_
request_ stringdomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic_
sort_ stringsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed_
measured_ stringhealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime number
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard_
names list(string) - Predefined health-check target name.
- ftp_
file string - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp_
mode string - FTP mode. Valid values:
passive,port. - ha_
priority number - HA election priority (1 - 50).
- http_
agent string - String in the http-agent field in the HTTP header.
- http_
get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http_
match string - Response string expected from the server if the protocol is HTTP.
- interval number
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter_
weight number - Coefficient of jitter in the formula of custom-profile-1.
- latency_
weight number - Coefficient of latency in the formula of custom-profile-1.
- members list(string)
- Member sequence number list.
- mos_
codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name string
- Status check or health check name.
- packet_
loss_ numberweight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet_
size number - Packet size of a twamp test session,
- passwords list(string)
- Twamp controller password in authentication mode
- port number
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe_
count number - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe_
packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe_
timeout number - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality_
measured_ stringmethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime number
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote_
probe_ numbertimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security_
mode string - Twamp controller security mode. Valid values:
none,authentication. - servers list(string)
- IP address or FQDN name of the server.
- sla_
fail_ numberlog_ period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla_
id_ numberredistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla_
pass_ numberlog_ period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas list(object)
- Sla. The structure of
slablock is documented below. - source string
- Source IP address used in the health-check packet to the server.
- source6 string
- Source IPv6 addressused in the health-check packet to server.
- system_
dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold_
alert_ numberjitter - Alert threshold for jitter (ms, default = 0).
- threshold_
alert_ numberlatency - Alert threshold for latency (ms, default = 0).
- threshold_
alert_ numberpacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold_
warning_ numberjitter - Warning threshold for jitter (ms, default = 0).
- threshold_
warning_ numberlatency - Warning threshold for latency (ms, default = 0).
- threshold_
warning_ numberpacketloss - Warning threshold for packet loss (percentage, default = 0).
- update_
bgp_ stringroute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update_
cascade_ stringinterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update_
if_ boolexist - update_
static_ stringroute - Enable/disable updating the static route. Valid values:
disable,enable. - user string
- The user name to access probe server.
- vrf number
- Virtual Routing Forwarding ID.
- wantemp_
system_ stringsdwan_ healthcheck_ id - an identifier for the resource with format {{name}}.
- wanprof String
- Wanprof.
- _
dynamic StringServer - _Dynamic-Server.
- addr
Mode String - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent
Probe DoubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth
Weight Double - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class
Id String - Traffic class ID.
- detect
Mode String - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode String
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns
Match StringIp - Response IP expected from DNS server if the protocol is DNS.
- dns
Request StringDomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed
Measured StringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime Double
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard String
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard
Names List<String> - Predefined health-check target name.
- ftp
File String - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp
Mode String - FTP mode. Valid values:
passive,port. - ha
Priority Double - HA election priority (1 - 50).
- http
Agent String - String in the http-agent field in the HTTP header.
- http
Get String - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http
Match String - Response string expected from the server if the protocol is HTTP.
- interval Double
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter
Weight Double - Coefficient of jitter in the formula of custom-profile-1.
- latency
Weight Double - Coefficient of latency in the formula of custom-profile-1.
- members List<String>
- Member sequence number list.
- mos
Codec String - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name String
- Status check or health check name.
- packet
Loss DoubleWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet
Size Double - Packet size of a twamp test session,
- passwords List<String>
- Twamp controller password in authentication mode
- port Double
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe
Count Double - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe
Packets String - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe
Timeout Double - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol String
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality
Measured StringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime Double
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote
Probe DoubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security
Mode String - Twamp controller security mode. Valid values:
none,authentication. - servers List<String>
- IP address or FQDN name of the server.
- sla
Fail DoubleLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla
Id DoubleRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla
Pass DoubleLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas
List<Wantemp
System Sdwan Healthcheck Sla> - Sla. The structure of
slablock is documented below. - source String
- Source IP address used in the health-check packet to the server.
- source6 String
- Source IPv6 addressused in the health-check packet to server.
- system
Dns String - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold
Alert DoubleJitter - Alert threshold for jitter (ms, default = 0).
- threshold
Alert DoubleLatency - Alert threshold for latency (ms, default = 0).
- threshold
Alert DoublePacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold
Warning DoubleJitter - Warning threshold for jitter (ms, default = 0).
- threshold
Warning DoubleLatency - Warning threshold for latency (ms, default = 0).
- threshold
Warning DoublePacketloss - Warning threshold for packet loss (percentage, default = 0).
- update
Bgp StringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update
Cascade StringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update
If BooleanExist - update
Static StringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - user String
- The user name to access probe server.
- vrf Double
- Virtual Routing Forwarding ID.
- wantemp
System StringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- wanprof string
- Wanprof.
- _
dynamic stringServer - _Dynamic-Server.
- addr
Mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent
Probe numberTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth
Weight number - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class
Id string - Traffic class ID.
- detect
Mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns
Match stringIp - Response IP expected from DNS server if the protocol is DNS.
- dns
Request stringDomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed
Measured stringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime number
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard
Names string[] - Predefined health-check target name.
- ftp
File string - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp
Mode string - FTP mode. Valid values:
passive,port. - ha
Priority number - HA election priority (1 - 50).
- http
Agent string - String in the http-agent field in the HTTP header.
- http
Get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http
Match string - Response string expected from the server if the protocol is HTTP.
- interval number
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter
Weight number - Coefficient of jitter in the formula of custom-profile-1.
- latency
Weight number - Coefficient of latency in the formula of custom-profile-1.
- members string[]
- Member sequence number list.
- mos
Codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name string
- Status check or health check name.
- packet
Loss numberWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet
Size number - Packet size of a twamp test session,
- passwords string[]
- Twamp controller password in authentication mode
- port number
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe
Count number - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe
Packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe
Timeout number - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality
Measured stringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime number
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote
Probe numberTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security
Mode string - Twamp controller security mode. Valid values:
none,authentication. - servers string[]
- IP address or FQDN name of the server.
- sla
Fail numberLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla
Id numberRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla
Pass numberLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas
Wantemp
System Sdwan Healthcheck Sla[] - Sla. The structure of
slablock is documented below. - source string
- Source IP address used in the health-check packet to the server.
- source6 string
- Source IPv6 addressused in the health-check packet to server.
- system
Dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold
Alert numberJitter - Alert threshold for jitter (ms, default = 0).
- threshold
Alert numberLatency - Alert threshold for latency (ms, default = 0).
- threshold
Alert numberPacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold
Warning numberJitter - Warning threshold for jitter (ms, default = 0).
- threshold
Warning numberLatency - Warning threshold for latency (ms, default = 0).
- threshold
Warning numberPacketloss - Warning threshold for packet loss (percentage, default = 0).
- update
Bgp stringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update
Cascade stringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update
If booleanExist - update
Static stringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - user string
- The user name to access probe server.
- vrf number
- Virtual Routing Forwarding ID.
- wantemp
System stringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- wanprof str
- Wanprof.
- _
dynamic_ strserver - _Dynamic-Server.
- addr_
mode str - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent_
probe_ floattimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth_
weight float - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class_
id str - Traffic class ID.
- detect_
mode str - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode str
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns_
match_ strip - Response IP expected from DNS server if the protocol is DNS.
- dns_
request_ strdomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic_
sort_ strsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed_
measured_ strhealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime float
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard str
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard_
names Sequence[str] - Predefined health-check target name.
- ftp_
file str - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp_
mode str - FTP mode. Valid values:
passive,port. - ha_
priority float - HA election priority (1 - 50).
- http_
agent str - String in the http-agent field in the HTTP header.
- http_
get str - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http_
match str - Response string expected from the server if the protocol is HTTP.
- interval float
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter_
weight float - Coefficient of jitter in the formula of custom-profile-1.
- latency_
weight float - Coefficient of latency in the formula of custom-profile-1.
- members Sequence[str]
- Member sequence number list.
- mos_
codec str - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name str
- Status check or health check name.
- packet_
loss_ floatweight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet_
size float - Packet size of a twamp test session,
- passwords Sequence[str]
- Twamp controller password in authentication mode
- port float
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe_
count float - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe_
packets str - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe_
timeout float - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol str
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality_
measured_ strmethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime float
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote_
probe_ floattimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security_
mode str - Twamp controller security mode. Valid values:
none,authentication. - servers Sequence[str]
- IP address or FQDN name of the server.
- sla_
fail_ floatlog_ period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla_
id_ floatredistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla_
pass_ floatlog_ period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas
Sequence[Wantemp
System Sdwan Healthcheck Sla Args] - Sla. The structure of
slablock is documented below. - source str
- Source IP address used in the health-check packet to the server.
- source6 str
- Source IPv6 addressused in the health-check packet to server.
- system_
dns str - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold_
alert_ floatjitter - Alert threshold for jitter (ms, default = 0).
- threshold_
alert_ floatlatency - Alert threshold for latency (ms, default = 0).
- threshold_
alert_ floatpacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold_
warning_ floatjitter - Warning threshold for jitter (ms, default = 0).
- threshold_
warning_ floatlatency - Warning threshold for latency (ms, default = 0).
- threshold_
warning_ floatpacketloss - Warning threshold for packet loss (percentage, default = 0).
- update_
bgp_ strroute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update_
cascade_ strinterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update_
if_ boolexist - update_
static_ strroute - Enable/disable updating the static route. Valid values:
disable,enable. - user str
- The user name to access probe server.
- vrf float
- Virtual Routing Forwarding ID.
- wantemp_
system_ strsdwan_ healthcheck_ id - an identifier for the resource with format {{name}}.
- wanprof String
- Wanprof.
- _
dynamic StringServer - _Dynamic-Server.
- addr
Mode String - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent
Probe NumberTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth
Weight Number - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class
Id String - Traffic class ID.
- detect
Mode String - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode String
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns
Match StringIp - Response IP expected from DNS server if the protocol is DNS.
- dns
Request StringDomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed
Measured StringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime Number
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard String
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard
Names List<String> - Predefined health-check target name.
- ftp
File String - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp
Mode String - FTP mode. Valid values:
passive,port. - ha
Priority Number - HA election priority (1 - 50).
- http
Agent String - String in the http-agent field in the HTTP header.
- http
Get String - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http
Match String - Response string expected from the server if the protocol is HTTP.
- interval Number
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter
Weight Number - Coefficient of jitter in the formula of custom-profile-1.
- latency
Weight Number - Coefficient of latency in the formula of custom-profile-1.
- members List<String>
- Member sequence number list.
- mos
Codec String - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name String
- Status check or health check name.
- packet
Loss NumberWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet
Size Number - Packet size of a twamp test session,
- passwords List<String>
- Twamp controller password in authentication mode
- port Number
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe
Count Number - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe
Packets String - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe
Timeout Number - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol String
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality
Measured StringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime Number
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote
Probe NumberTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security
Mode String - Twamp controller security mode. Valid values:
none,authentication. - servers List<String>
- IP address or FQDN name of the server.
- sla
Fail NumberLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla
Id NumberRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla
Pass NumberLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas List<Property Map>
- Sla. The structure of
slablock is documented below. - source String
- Source IP address used in the health-check packet to the server.
- source6 String
- Source IPv6 addressused in the health-check packet to server.
- system
Dns String - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold
Alert NumberJitter - Alert threshold for jitter (ms, default = 0).
- threshold
Alert NumberLatency - Alert threshold for latency (ms, default = 0).
- threshold
Alert NumberPacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold
Warning NumberJitter - Warning threshold for jitter (ms, default = 0).
- threshold
Warning NumberLatency - Warning threshold for latency (ms, default = 0).
- threshold
Warning NumberPacketloss - Warning threshold for packet loss (percentage, default = 0).
- update
Bgp StringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update
Cascade StringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update
If BooleanExist - update
Static StringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - user String
- The user name to access probe server.
- vrf Number
- Virtual Routing Forwarding ID.
- wantemp
System StringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
Outputs
All input properties are implicitly available as output properties. Additionally, the WantempSystemSdwanHealthcheck resource produces the following output properties:
- Id string
- The provider-assigned unique ID for this managed resource.
- Id string
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id str
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
Look up Existing WantempSystemSdwanHealthcheck Resource
Get an existing WantempSystemSdwanHealthcheck resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.
public static get(name: string, id: Input<ID>, state?: WantempSystemSdwanHealthcheckState, opts?: CustomResourceOptions): WantempSystemSdwanHealthcheck@staticmethod
def get(resource_name: str,
id: str,
opts: Optional[ResourceOptions] = None,
_dynamic_server: Optional[str] = None,
addr_mode: Optional[str] = None,
adom: Optional[str] = None,
agent_probe_timeout: Optional[float] = None,
bandwidth_weight: Optional[float] = None,
class_id: Optional[str] = None,
detect_mode: Optional[str] = None,
diffservcode: Optional[str] = None,
dns_match_ip: Optional[str] = None,
dns_request_domain: Optional[str] = None,
dynamic_sort_subtable: Optional[str] = None,
embed_measured_health: Optional[str] = None,
failtime: Optional[float] = None,
fortiguard: Optional[str] = None,
fortiguard_names: Optional[Sequence[str]] = None,
ftp_file: Optional[str] = None,
ftp_mode: Optional[str] = None,
ha_priority: Optional[float] = None,
http_agent: Optional[str] = None,
http_get: Optional[str] = None,
http_match: Optional[str] = None,
interval: Optional[float] = None,
jitter_weight: Optional[float] = None,
latency_weight: Optional[float] = None,
members: Optional[Sequence[str]] = None,
mos_codec: Optional[str] = None,
name: Optional[str] = None,
packet_loss_weight: Optional[float] = None,
packet_size: Optional[float] = None,
passwords: Optional[Sequence[str]] = None,
port: Optional[float] = None,
probe_count: Optional[float] = None,
probe_packets: Optional[str] = None,
probe_timeout: Optional[float] = None,
protocol: Optional[str] = None,
quality_measured_method: Optional[str] = None,
recoverytime: Optional[float] = None,
remote_probe_timeout: Optional[float] = None,
scopetype: Optional[str] = None,
security_mode: Optional[str] = None,
servers: Optional[Sequence[str]] = None,
sla_fail_log_period: Optional[float] = None,
sla_id_redistribute: Optional[float] = None,
sla_pass_log_period: Optional[float] = None,
slas: Optional[Sequence[WantempSystemSdwanHealthcheckSlaArgs]] = None,
source: Optional[str] = None,
source6: Optional[str] = None,
system_dns: Optional[str] = None,
threshold_alert_jitter: Optional[float] = None,
threshold_alert_latency: Optional[float] = None,
threshold_alert_packetloss: Optional[float] = None,
threshold_warning_jitter: Optional[float] = None,
threshold_warning_latency: Optional[float] = None,
threshold_warning_packetloss: Optional[float] = None,
update_bgp_route: Optional[str] = None,
update_cascade_interface: Optional[str] = None,
update_if_exist: Optional[bool] = None,
update_static_route: Optional[str] = None,
user: Optional[str] = None,
vrf: Optional[float] = None,
wanprof: Optional[str] = None,
wantemp_system_sdwan_healthcheck_id: Optional[str] = None) -> WantempSystemSdwanHealthcheckfunc GetWantempSystemSdwanHealthcheck(ctx *Context, name string, id IDInput, state *WantempSystemSdwanHealthcheckState, opts ...ResourceOption) (*WantempSystemSdwanHealthcheck, error)public static WantempSystemSdwanHealthcheck Get(string name, Input<string> id, WantempSystemSdwanHealthcheckState? state, CustomResourceOptions? opts = null)public static WantempSystemSdwanHealthcheck get(String name, Output<String> id, WantempSystemSdwanHealthcheckState state, CustomResourceOptions options)resources: _: type: fortimanager:WantempSystemSdwanHealthcheck get: id: ${id}import {
to = fortimanager_wantempsystemsdwanhealthcheck.example
id = "${id}"
}
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- resource_name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- Addr
Mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Agent
Probe doubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- Bandwidth
Weight double - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- Class
Id string - Traffic class ID.
- Detect
Mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - Diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- Dns
Match stringIp - Response IP expected from DNS server if the protocol is DNS.
- Dns
Request stringDomain - Fully qualified domain name to resolve for the DNS probe.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Embed
Measured stringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - Failtime double
- Number of failures before server is considered lost (1 - 3600, default = 5).
- Fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - Fortiguard
Names List<string> - Predefined health-check target name.
- Ftp
File string - Full path and file name on the FTP server to download for FTP health-check to probe.
- Ftp
Mode string - FTP mode. Valid values:
passive,port. - Ha
Priority double - HA election priority (1 - 50).
- Http
Agent string - String in the http-agent field in the HTTP header.
- Http
Get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- Http
Match string - Response string expected from the server if the protocol is HTTP.
- Interval double
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- Jitter
Weight double - Coefficient of jitter in the formula of custom-profile-1.
- Latency
Weight double - Coefficient of latency in the formula of custom-profile-1.
- Members List<string>
- Member sequence number list.
- Mos
Codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - Name string
- Status check or health check name.
- Packet
Loss doubleWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- Packet
Size double - Packet size of a twamp test session,
- Passwords List<string>
- Twamp controller password in authentication mode
- Port double
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- Probe
Count double - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- Probe
Packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - Probe
Timeout double - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- Protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - Quality
Measured stringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - Recoverytime double
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- Remote
Probe doubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Security
Mode string - Twamp controller security mode. Valid values:
none,authentication. - Servers List<string>
- IP address or FQDN name of the server.
- Sla
Fail doubleLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- Sla
Id doubleRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- Sla
Pass doubleLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- Slas
List<Wantemp
System Sdwan Healthcheck Sla> - Sla. The structure of
slablock is documented below. - Source string
- Source IP address used in the health-check packet to the server.
- Source6 string
- Source IPv6 addressused in the health-check packet to server.
- System
Dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - Threshold
Alert doubleJitter - Alert threshold for jitter (ms, default = 0).
- Threshold
Alert doubleLatency - Alert threshold for latency (ms, default = 0).
- Threshold
Alert doublePacketloss - Alert threshold for packet loss (percentage, default = 0).
- Threshold
Warning doubleJitter - Warning threshold for jitter (ms, default = 0).
- Threshold
Warning doubleLatency - Warning threshold for latency (ms, default = 0).
- Threshold
Warning doublePacketloss - Warning threshold for packet loss (percentage, default = 0).
- Update
Bgp stringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - Update
Cascade stringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - Update
If boolExist - Update
Static stringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - User string
- The user name to access probe server.
- Vrf double
- Virtual Routing Forwarding ID.
- Wanprof string
- Wanprof.
- Wantemp
System stringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- _
dynamic stringServer - _Dynamic-Server.
- Addr
Mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Agent
Probe float64Timeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- Bandwidth
Weight float64 - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- Class
Id string - Traffic class ID.
- Detect
Mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - Diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- Dns
Match stringIp - Response IP expected from DNS server if the protocol is DNS.
- Dns
Request stringDomain - Fully qualified domain name to resolve for the DNS probe.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Embed
Measured stringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - Failtime float64
- Number of failures before server is considered lost (1 - 3600, default = 5).
- Fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - Fortiguard
Names []string - Predefined health-check target name.
- Ftp
File string - Full path and file name on the FTP server to download for FTP health-check to probe.
- Ftp
Mode string - FTP mode. Valid values:
passive,port. - Ha
Priority float64 - HA election priority (1 - 50).
- Http
Agent string - String in the http-agent field in the HTTP header.
- Http
Get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- Http
Match string - Response string expected from the server if the protocol is HTTP.
- Interval float64
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- Jitter
Weight float64 - Coefficient of jitter in the formula of custom-profile-1.
- Latency
Weight float64 - Coefficient of latency in the formula of custom-profile-1.
- Members []string
- Member sequence number list.
- Mos
Codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - Name string
- Status check or health check name.
- Packet
Loss float64Weight - Coefficient of packet-loss in the formula of custom-profile-1.
- Packet
Size float64 - Packet size of a twamp test session,
- Passwords []string
- Twamp controller password in authentication mode
- Port float64
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- Probe
Count float64 - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- Probe
Packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - Probe
Timeout float64 - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- Protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - Quality
Measured stringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - Recoverytime float64
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- Remote
Probe float64Timeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Security
Mode string - Twamp controller security mode. Valid values:
none,authentication. - Servers []string
- IP address or FQDN name of the server.
- Sla
Fail float64Log Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- Sla
Id float64Redistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- Sla
Pass float64Log Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- Slas
[]Wantemp
System Sdwan Healthcheck Sla Type Args - Sla. The structure of
slablock is documented below. - Source string
- Source IP address used in the health-check packet to the server.
- Source6 string
- Source IPv6 addressused in the health-check packet to server.
- System
Dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - Threshold
Alert float64Jitter - Alert threshold for jitter (ms, default = 0).
- Threshold
Alert float64Latency - Alert threshold for latency (ms, default = 0).
- Threshold
Alert float64Packetloss - Alert threshold for packet loss (percentage, default = 0).
- Threshold
Warning float64Jitter - Warning threshold for jitter (ms, default = 0).
- Threshold
Warning float64Latency - Warning threshold for latency (ms, default = 0).
- Threshold
Warning float64Packetloss - Warning threshold for packet loss (percentage, default = 0).
- Update
Bgp stringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - Update
Cascade stringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - Update
If boolExist - Update
Static stringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - User string
- The user name to access probe server.
- Vrf float64
- Virtual Routing Forwarding ID.
- Wanprof string
- Wanprof.
- Wantemp
System stringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- _
dynamic stringServer - _Dynamic-Server.
- _
dynamic_ stringserver - _Dynamic-Server.
- addr_
mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent_
probe_ numbertimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth_
weight number - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class_
id string - Traffic class ID.
- detect_
mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns_
match_ stringip - Response IP expected from DNS server if the protocol is DNS.
- dns_
request_ stringdomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic_
sort_ stringsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed_
measured_ stringhealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime number
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard_
names list(string) - Predefined health-check target name.
- ftp_
file string - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp_
mode string - FTP mode. Valid values:
passive,port. - ha_
priority number - HA election priority (1 - 50).
- http_
agent string - String in the http-agent field in the HTTP header.
- http_
get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http_
match string - Response string expected from the server if the protocol is HTTP.
- interval number
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter_
weight number - Coefficient of jitter in the formula of custom-profile-1.
- latency_
weight number - Coefficient of latency in the formula of custom-profile-1.
- members list(string)
- Member sequence number list.
- mos_
codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name string
- Status check or health check name.
- packet_
loss_ numberweight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet_
size number - Packet size of a twamp test session,
- passwords list(string)
- Twamp controller password in authentication mode
- port number
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe_
count number - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe_
packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe_
timeout number - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality_
measured_ stringmethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime number
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote_
probe_ numbertimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security_
mode string - Twamp controller security mode. Valid values:
none,authentication. - servers list(string)
- IP address or FQDN name of the server.
- sla_
fail_ numberlog_ period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla_
id_ numberredistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla_
pass_ numberlog_ period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas list(object)
- Sla. The structure of
slablock is documented below. - source string
- Source IP address used in the health-check packet to the server.
- source6 string
- Source IPv6 addressused in the health-check packet to server.
- system_
dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold_
alert_ numberjitter - Alert threshold for jitter (ms, default = 0).
- threshold_
alert_ numberlatency - Alert threshold for latency (ms, default = 0).
- threshold_
alert_ numberpacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold_
warning_ numberjitter - Warning threshold for jitter (ms, default = 0).
- threshold_
warning_ numberlatency - Warning threshold for latency (ms, default = 0).
- threshold_
warning_ numberpacketloss - Warning threshold for packet loss (percentage, default = 0).
- update_
bgp_ stringroute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update_
cascade_ stringinterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update_
if_ boolexist - update_
static_ stringroute - Enable/disable updating the static route. Valid values:
disable,enable. - user string
- The user name to access probe server.
- vrf number
- Virtual Routing Forwarding ID.
- wanprof string
- Wanprof.
- wantemp_
system_ stringsdwan_ healthcheck_ id - an identifier for the resource with format {{name}}.
- _
dynamic StringServer - _Dynamic-Server.
- addr
Mode String - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent
Probe DoubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth
Weight Double - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class
Id String - Traffic class ID.
- detect
Mode String - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode String
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns
Match StringIp - Response IP expected from DNS server if the protocol is DNS.
- dns
Request StringDomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed
Measured StringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime Double
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard String
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard
Names List<String> - Predefined health-check target name.
- ftp
File String - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp
Mode String - FTP mode. Valid values:
passive,port. - ha
Priority Double - HA election priority (1 - 50).
- http
Agent String - String in the http-agent field in the HTTP header.
- http
Get String - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http
Match String - Response string expected from the server if the protocol is HTTP.
- interval Double
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter
Weight Double - Coefficient of jitter in the formula of custom-profile-1.
- latency
Weight Double - Coefficient of latency in the formula of custom-profile-1.
- members List<String>
- Member sequence number list.
- mos
Codec String - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name String
- Status check or health check name.
- packet
Loss DoubleWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet
Size Double - Packet size of a twamp test session,
- passwords List<String>
- Twamp controller password in authentication mode
- port Double
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe
Count Double - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe
Packets String - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe
Timeout Double - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol String
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality
Measured StringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime Double
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote
Probe DoubleTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security
Mode String - Twamp controller security mode. Valid values:
none,authentication. - servers List<String>
- IP address or FQDN name of the server.
- sla
Fail DoubleLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla
Id DoubleRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla
Pass DoubleLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas
List<Wantemp
System Sdwan Healthcheck Sla> - Sla. The structure of
slablock is documented below. - source String
- Source IP address used in the health-check packet to the server.
- source6 String
- Source IPv6 addressused in the health-check packet to server.
- system
Dns String - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold
Alert DoubleJitter - Alert threshold for jitter (ms, default = 0).
- threshold
Alert DoubleLatency - Alert threshold for latency (ms, default = 0).
- threshold
Alert DoublePacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold
Warning DoubleJitter - Warning threshold for jitter (ms, default = 0).
- threshold
Warning DoubleLatency - Warning threshold for latency (ms, default = 0).
- threshold
Warning DoublePacketloss - Warning threshold for packet loss (percentage, default = 0).
- update
Bgp StringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update
Cascade StringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update
If BooleanExist - update
Static StringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - user String
- The user name to access probe server.
- vrf Double
- Virtual Routing Forwarding ID.
- wanprof String
- Wanprof.
- wantemp
System StringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- _
dynamic stringServer - _Dynamic-Server.
- addr
Mode string - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent
Probe numberTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth
Weight number - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class
Id string - Traffic class ID.
- detect
Mode string - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode string
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns
Match stringIp - Response IP expected from DNS server if the protocol is DNS.
- dns
Request stringDomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed
Measured stringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime number
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard string
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard
Names string[] - Predefined health-check target name.
- ftp
File string - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp
Mode string - FTP mode. Valid values:
passive,port. - ha
Priority number - HA election priority (1 - 50).
- http
Agent string - String in the http-agent field in the HTTP header.
- http
Get string - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http
Match string - Response string expected from the server if the protocol is HTTP.
- interval number
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter
Weight number - Coefficient of jitter in the formula of custom-profile-1.
- latency
Weight number - Coefficient of latency in the formula of custom-profile-1.
- members string[]
- Member sequence number list.
- mos
Codec string - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name string
- Status check or health check name.
- packet
Loss numberWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet
Size number - Packet size of a twamp test session,
- passwords string[]
- Twamp controller password in authentication mode
- port number
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe
Count number - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe
Packets string - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe
Timeout number - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol string
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality
Measured stringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime number
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote
Probe numberTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security
Mode string - Twamp controller security mode. Valid values:
none,authentication. - servers string[]
- IP address or FQDN name of the server.
- sla
Fail numberLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla
Id numberRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla
Pass numberLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas
Wantemp
System Sdwan Healthcheck Sla[] - Sla. The structure of
slablock is documented below. - source string
- Source IP address used in the health-check packet to the server.
- source6 string
- Source IPv6 addressused in the health-check packet to server.
- system
Dns string - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold
Alert numberJitter - Alert threshold for jitter (ms, default = 0).
- threshold
Alert numberLatency - Alert threshold for latency (ms, default = 0).
- threshold
Alert numberPacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold
Warning numberJitter - Warning threshold for jitter (ms, default = 0).
- threshold
Warning numberLatency - Warning threshold for latency (ms, default = 0).
- threshold
Warning numberPacketloss - Warning threshold for packet loss (percentage, default = 0).
- update
Bgp stringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update
Cascade stringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update
If booleanExist - update
Static stringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - user string
- The user name to access probe server.
- vrf number
- Virtual Routing Forwarding ID.
- wanprof string
- Wanprof.
- wantemp
System stringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
- _
dynamic_ strserver - _Dynamic-Server.
- addr_
mode str - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent_
probe_ floattimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth_
weight float - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class_
id str - Traffic class ID.
- detect_
mode str - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode str
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns_
match_ strip - Response IP expected from DNS server if the protocol is DNS.
- dns_
request_ strdomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic_
sort_ strsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed_
measured_ strhealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime float
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard str
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard_
names Sequence[str] - Predefined health-check target name.
- ftp_
file str - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp_
mode str - FTP mode. Valid values:
passive,port. - ha_
priority float - HA election priority (1 - 50).
- http_
agent str - String in the http-agent field in the HTTP header.
- http_
get str - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http_
match str - Response string expected from the server if the protocol is HTTP.
- interval float
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter_
weight float - Coefficient of jitter in the formula of custom-profile-1.
- latency_
weight float - Coefficient of latency in the formula of custom-profile-1.
- members Sequence[str]
- Member sequence number list.
- mos_
codec str - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name str
- Status check or health check name.
- packet_
loss_ floatweight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet_
size float - Packet size of a twamp test session,
- passwords Sequence[str]
- Twamp controller password in authentication mode
- port float
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe_
count float - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe_
packets str - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe_
timeout float - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol str
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality_
measured_ strmethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime float
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote_
probe_ floattimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security_
mode str - Twamp controller security mode. Valid values:
none,authentication. - servers Sequence[str]
- IP address or FQDN name of the server.
- sla_
fail_ floatlog_ period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla_
id_ floatredistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla_
pass_ floatlog_ period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas
Sequence[Wantemp
System Sdwan Healthcheck Sla Args] - Sla. The structure of
slablock is documented below. - source str
- Source IP address used in the health-check packet to the server.
- source6 str
- Source IPv6 addressused in the health-check packet to server.
- system_
dns str - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold_
alert_ floatjitter - Alert threshold for jitter (ms, default = 0).
- threshold_
alert_ floatlatency - Alert threshold for latency (ms, default = 0).
- threshold_
alert_ floatpacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold_
warning_ floatjitter - Warning threshold for jitter (ms, default = 0).
- threshold_
warning_ floatlatency - Warning threshold for latency (ms, default = 0).
- threshold_
warning_ floatpacketloss - Warning threshold for packet loss (percentage, default = 0).
- update_
bgp_ strroute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update_
cascade_ strinterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update_
if_ boolexist - update_
static_ strroute - Enable/disable updating the static route. Valid values:
disable,enable. - user str
- The user name to access probe server.
- vrf float
- Virtual Routing Forwarding ID.
- wanprof str
- Wanprof.
- wantemp_
system_ strsdwan_ healthcheck_ id - an identifier for the resource with format {{name}}.
- _
dynamic StringServer - _Dynamic-Server.
- addr
Mode String - Address mode (IPv4 or IPv6). Valid values:
ipv4,ipv6. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - agent
Probe NumberTimeout - Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
- bandwidth
Weight Number - Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
- class
Id String - Traffic class ID.
- detect
Mode String - The mode determining how to detect the server. Valid values:
active,passive,prefer-passive. - diffservcode String
- Differentiated services code point (DSCP) in the IP header of the probe packet.
- dns
Match StringIp - Response IP expected from DNS server if the protocol is DNS.
- dns
Request StringDomain - Fully qualified domain name to resolve for the DNS probe.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- embed
Measured StringHealth - Enable/disable embedding measured health information. Valid values:
disable,enable. - failtime Number
- Number of failures before server is considered lost (1 - 3600, default = 5).
- fortiguard String
- Enable/disable use of FortiGuard predefined server. Valid values:
disable,enable. - fortiguard
Names List<String> - Predefined health-check target name.
- ftp
File String - Full path and file name on the FTP server to download for FTP health-check to probe.
- ftp
Mode String - FTP mode. Valid values:
passive,port. - ha
Priority Number - HA election priority (1 - 50).
- http
Agent String - String in the http-agent field in the HTTP header.
- http
Get String - URL used to communicate with the server if the protocol if the protocol is HTTP.
- http
Match String - Response string expected from the server if the protocol is HTTP.
- interval Number
- Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
- jitter
Weight Number - Coefficient of jitter in the formula of custom-profile-1.
- latency
Weight Number - Coefficient of latency in the formula of custom-profile-1.
- members List<String>
- Member sequence number list.
- mos
Codec String - Codec to use for MOS calculation (default = g711). Valid values:
g711,g722,g729. - name String
- Status check or health check name.
- packet
Loss NumberWeight - Coefficient of packet-loss in the formula of custom-profile-1.
- packet
Size Number - Packet size of a twamp test session,
- passwords List<String>
- Twamp controller password in authentication mode
- port Number
- Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
- probe
Count Number - Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
- probe
Packets String - Enable/disable transmission of probe packets. Valid values:
disable,enable. - probe
Timeout Number - Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
- protocol String
- Protocol used to determine if the FortiGate can communicate with the server. Valid values:
ping,tcp-echo,udp-echo,http,twamp,ping6,dns,tcp-connect,ftp. - quality
Measured StringMethod - Method to measure the quality of tcp-connect. Valid values:
half-close,half-open. - recoverytime Number
- Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
- remote
Probe NumberTimeout - Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - security
Mode String - Twamp controller security mode. Valid values:
none,authentication. - servers List<String>
- IP address or FQDN name of the server.
- sla
Fail NumberLog Period - Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
- sla
Id NumberRedistribute - Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
- sla
Pass NumberLog Period - Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
- slas List<Property Map>
- Sla. The structure of
slablock is documented below. - source String
- Source IP address used in the health-check packet to the server.
- source6 String
- Source IPv6 addressused in the health-check packet to server.
- system
Dns String - Enable/disable system DNS as the probe server. Valid values:
disable,enable. - threshold
Alert NumberJitter - Alert threshold for jitter (ms, default = 0).
- threshold
Alert NumberLatency - Alert threshold for latency (ms, default = 0).
- threshold
Alert NumberPacketloss - Alert threshold for packet loss (percentage, default = 0).
- threshold
Warning NumberJitter - Warning threshold for jitter (ms, default = 0).
- threshold
Warning NumberLatency - Warning threshold for latency (ms, default = 0).
- threshold
Warning NumberPacketloss - Warning threshold for packet loss (percentage, default = 0).
- update
Bgp StringRoute - Enable/disable updating the BGP route. Valid values:
disable,enable. - update
Cascade StringInterface - Enable/disable update cascade interface. Valid values:
disable,enable. - update
If BooleanExist - update
Static StringRoute - Enable/disable updating the static route. Valid values:
disable,enable. - user String
- The user name to access probe server.
- vrf Number
- Virtual Routing Forwarding ID.
- wanprof String
- Wanprof.
- wantemp
System StringSdwan Healthcheck Id - an identifier for the resource with format {{name}}.
Supporting Types
WantempSystemSdwanHealthcheckSla, WantempSystemSdwanHealthcheckSlaArgs
- Custom
Profile doubleThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- Id double
- SLA ID.
- Jitter
Threshold double - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Latency
Threshold double - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Link
Cost List<string>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - Mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- Packetloss
Threshold double - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- Priority
In doubleSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- Priority
Out doubleSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- Custom
Profile float64Threshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- Id float64
- SLA ID.
- Jitter
Threshold float64 - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Latency
Threshold float64 - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- Link
Cost []stringFactors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - Mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- Packetloss
Threshold float64 - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- Priority
In float64Sla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- Priority
Out float64Sla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- custom_
profile_ numberthreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- id number
- SLA ID.
- jitter_
threshold number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency_
threshold number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link_
cost_ list(string)factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos_
threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss_
threshold number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority_
in_ numbersla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority_
out_ numbersla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- custom
Profile DoubleThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- id Double
- SLA ID.
- jitter
Threshold Double - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold Double - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost List<String>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold String - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold Double - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In DoubleSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out DoubleSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- custom
Profile numberThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- id number
- SLA ID.
- jitter
Threshold number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost string[]Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold string - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In numberSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out numberSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- custom_
profile_ floatthreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- id float
- SLA ID.
- jitter_
threshold float - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency_
threshold float - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link_
cost_ Sequence[str]factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos_
threshold str - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss_
threshold float - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority_
in_ floatsla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority_
out_ floatsla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
- custom
Profile NumberThreshold - Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
- id Number
- SLA ID.
- jitter
Threshold Number - Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- latency
Threshold Number - Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
- link
Cost List<String>Factors - Criteria on which to base link selection. Valid values:
latency,jitter,packet-loss. - mos
Threshold String - Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
- packetloss
Threshold Number - Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
- priority
In NumberSla - Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
- priority
Out NumberSla - Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
Import
Wantemp SystemSdwanHealthCheck can be imported using any of these accepted formats:
Set import_options = [“wanprof=YOUR_VALUE”] in the provider section.
$ export “FORTIMANAGER_IMPORT_TABLE”=“true”
$ pulumi import fortimanager:index/wantempSystemSdwanHealthcheck:WantempSystemSdwanHealthcheck labelname {{name}}
$ unset “FORTIMANAGER_IMPORT_TABLE”
-> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.
To learn more about importing existing cloud resources, see Importing resources.
Package Details
- Repository
- fortimanager fortinetdev/terraform-provider-fortimanager
- License
- Notes
- This Pulumi package is based on the
fortimanagerTerraform Provider.
published on Monday, May 4, 2026 by fortinetdev